Lineage for d3r69b_ (3r69 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312603Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1312604Protein automated matches [190436] (4 species)
    not a true protein
  7. 1312703Species Mouse (Mus musculus) [TaxId:10090] [189959] (7 PDB entries)
  8. 1312707Domain d3r69b_: 3r69 B: [184816]
    automated match to d1gq5a_
    complexed with cit

Details for d3r69b_

PDB Entry: 3r69 (more details), 1.5 Å

PDB Description: molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1
PDB Compounds: (B:) Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger receptor class B member 1

SCOPe Domain Sequences for d3r69b_:

Sequence, based on SEQRES records: (download)

>d3r69b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsprvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngksvea
ldhdgvvemirkggdqttllvldkqeakl

Sequence, based on observed residues (ATOM records): (download)

>d3r69b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsprvvvikkgsngygfylragpegqiikdiepgspaeaaglknndlvvavngksveald
hdgvvemirkggdqttllvldkqeakl

SCOPe Domain Coordinates for d3r69b_:

Click to download the PDB-style file with coordinates for d3r69b_.
(The format of our PDB-style files is described here.)

Timeline for d3r69b_: