Lineage for d3qnda_ (3qnd A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117302Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1117303Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1117304Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
  6. 1117345Protein automated matches [190333] (3 species)
    not a true protein
  7. 1117386Species Human adenovirus 37 [TaxId:52275] [188823] (6 PDB entries)
  8. 1117398Domain d3qnda_: 3qnd A: [184536]
    automated match to d1uxaa_
    complexed with sia, zn

Details for d3qnda_

PDB Entry: 3qnd (more details), 2.4 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d3qnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qnda_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

SCOPe Domain Coordinates for d3qnda_:

Click to download the PDB-style file with coordinates for d3qnda_.
(The format of our PDB-style files is described here.)

Timeline for d3qnda_: