Lineage for d3qlma_ (3qlm A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099130Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1099131Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1099136Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 1099484Protein automated matches [190139] (25 species)
    not a true protein
  7. 1099582Species Pig (Sus scrofa) [TaxId:9823] [186957] (8 PDB entries)
  8. 1099589Domain d3qlma_: 3qlm A: [184475]
    automated match to d1hn4a_
    complexed with ca, plm

Details for d3qlma_

PDB Entry: 3qlm (more details), 2.5 Å

PDB Description: crystal structure of porcine pancreatic phospholipase a2 in complex with n-hexadecanoic acid
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3qlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlma_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d3qlma_:

Click to download the PDB-style file with coordinates for d3qlma_.
(The format of our PDB-style files is described here.)

Timeline for d3qlma_: