Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
Protein automated matches [190139] (19 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [186957] (8 PDB entries) |
Domain d3qlma_: 3qlm A: [184475] automated match to d1hn4a_ complexed with ca, plm |
PDB Entry: 3qlm (more details), 2.5 Å
SCOPe Domain Sequences for d3qlma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qlma_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt kkyc
Timeline for d3qlma_: