Lineage for d3pk0b_ (3pk0 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978425Species Mycobacterium smegmatis [TaxId:246196] [189539] (2 PDB entries)
  8. 978427Domain d3pk0b_: 3pk0 B: [183806]
    automated match to d2c07a1
    complexed with ca, cl, gol, peg

Details for d3pk0b_

PDB Entry: 3pk0 (more details), 1.75 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3pk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pk0b_ c.2.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
gpgsmfdlqgrsvvvtggtkgigrgiatvfaraganvavagrstadidacvadldqlgsg
kvigvqtdvsdraqcdalagraveefggidvvcanagvfpdaplatmtpeqlngifavnv
ngtfyavqacldaliasgsgrvvltssitgpitgypgwshygatkaaqlgfmrtaaiela
phkitvnaimpgnimtegllengeeyiasmarsipagalgtpedighlaaflatkeagyi
tgqaiavdggqvlpesldaiat

SCOPe Domain Coordinates for d3pk0b_:

Click to download the PDB-style file with coordinates for d3pk0b_.
(The format of our PDB-style files is described here.)

Timeline for d3pk0b_: