![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (35 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (7 PDB entries) |
![]() | Domain d3pina_: 3pin A: [183775] automated match to d1erva_ |
PDB Entry: 3pin (more details), 2.7 Å
SCOPe Domain Sequences for d3pina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pina_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvtqlksaseydsalasgdklvvvdffatwcgpskmiapmiekfaeqysdaafykldvde vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv
Timeline for d3pina_: