Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Enoyl-ACP reductase [51791] (10 species) |
Species Bacillus subtilis [TaxId:1423] [189591] (2 PDB entries) |
Domain d3oiga_: 3oig A: [183052] automated match to d1lxca_ complexed with imj, nad |
PDB Entry: 3oig (more details), 1.25 Å
SCOPe Domain Sequences for d3oiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oiga_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus subtilis [TaxId: 1423]} mnfslegrnivvmgvankrsiawgiarslheagarliftyagerleksvhelagtldrnd siilpcdvtndaeietcfasikeqvgvihgiahciafankeelvgeylntnrdgfllahn issysltavvkaarpmmteggsivtltylggelvmpnynvmgvakasldasvkylaadlg kenirvnsisagpirtlsakgisdfnsilkdieeraplrrtttpeevgdtaaflfsdmsr gitgenlhvdsgfhitarle
Timeline for d3oiga_: