SCOPe 2.08: Domain d3oiga1: 3oig A:1-258

Lineage for d3oiga1 (3oig A:1-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Bacillus subtilis [TaxId:1423] [189591] (2 PDB entries)

8. Domain d3oiga1: 3oig A:1-258 [183052]
   Other proteins in same PDB: d3oiga2
   automated match to d1lxca_
   complexed with imj, nad

Details for d3oiga1

PDB Entry: 3oig, 1.25 Å

PDB Description: Crystal Structure of Enoyl-ACP Reductases I (FabI) from B. subtilis (complex with NAD and INH)

PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d3oiga1:

Sequence; same for both SEQRES and ATOM records:

>d3oiga1 c.2.1.2 (A:1-258) Enoyl-ACP reductase {Bacillus subtilis [TaxId: 1423]}
mnfslegrnivvmgvankrsiawgiarslheagarliftyagerleksvhelagtldrnd
siilpcdvtndaeietcfasikeqvgvihgiahciafankeelvgeylntnrdgfllahn
issysltavvkaarpmmteggsivtltylggelvmpnynvmgvakasldasvkylaadlg
kenirvnsisagpirtlsakgisdfnsilkdieeraplrrtttpeevgdtaaflfsdmsr
gitgenlhvdsgfhitar

Timeline for d3oiga1:

• d3oiga1 first appeared in SCOPe 2.01, called d3oiga_
  
• d3oiga1 appears in SCOPe 2.07