SCOPe 2.05: Domain d3odfa_: 3odf A:

Lineage for d3odfa_ (3odf A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (117 PDB entries)

8. Domain d3odfa_: 3odf A: [182949]
   automated match to d1b0ea_
   complexed with na, so4

Details for d3odfa_

PDB Entry: 3odf, 1.1 Å

PDB Description: Comparison of the character and the speed of X-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15K. The data set was collected from region A of the crystal. Second step of radiation damage

PDB Compounds: (A:) Chymotrypsin-like elastase family member 1

SCOPe Domain Sequences for d3odfa_:

Sequence; same for both SEQRES and ATOM records:

>d3odfa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d3odfa_:

• d3odfa_ first appeared in SCOPe 2.01
  
• d3odfa_ appears in SCOPe 2.04
  
• d3odfa_ appears in SCOPe 2.06
  
• d3odfa_ appears in the current release, SCOPe 2.08