Lineage for d3odfa_ (3odf A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953496Protein Elastase [50536] (4 species)
  7. 953506Species Pig (Sus scrofa) [TaxId:9823] [50538] (114 PDB entries)
  8. 953512Domain d3odfa_: 3odf A: [182949]
    automated match to d1b0ea_
    complexed with na, so4

Details for d3odfa_

PDB Entry: 3odf (more details), 1.1 Å

PDB Description: Comparison of the character and the speed of X-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15K. The data set was collected from region A of the crystal. Second step of radiation damage
PDB Compounds: (A:) Chymotrypsin-like elastase family member 1

SCOPe Domain Sequences for d3odfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3odfa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d3odfa_:

Click to download the PDB-style file with coordinates for d3odfa_.
(The format of our PDB-style files is described here.)

Timeline for d3odfa_: