SCOP 1.63: Domain d1bmfb1: 1bmf B:380-510

Lineage for d1bmfb1 (1bmf B:380-510)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1bmfb1: 1bmf B:380-510 [18282]
   Other proteins in same PDB: d1bmfa2, d1bmfa3, d1bmfb2, d1bmfb3, d1bmfc2, d1bmfc3, d1bmfd2, d1bmfd3, d1bmfe2, d1bmfe3, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmfb1

PDB Entry: 1bmf, 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfb1:

Sequence; same for both SEQRES and ATOM records:

>d1bmfb1 a.69.1.1 (B:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d1bmfb1:

• d1bmfb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bmfb1 appears in SCOP 1.61
  
• d1bmfb1 appears in SCOP 1.65
  
• d1bmfb1 appears in the current release, SCOPe 2.08