Lineage for d1bmff2 (1bmf F:9-81)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231263Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 231264Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 231265Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 231266Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  7. 231270Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 231294Domain d1bmff2: 1bmf F:9-81 [26451]
    Other proteins in same PDB: d1bmfa1, d1bmfa3, d1bmfb1, d1bmfb3, d1bmfc1, d1bmfc3, d1bmfd1, d1bmfd3, d1bmfe1, d1bmfe3, d1bmff1, d1bmff3, d1bmfg_
    complexed with adp, anp, mg

Details for d1bmff2

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmff2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1bmff2:

Click to download the PDB-style file with coordinates for d1bmff2.
(The format of our PDB-style files is described here.)

Timeline for d1bmff2: