![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries) Uniprot P00829 |
![]() | Domain d1e79f1: 1e79 F:358-474 [18274] Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d2, d1e79d3, d1e79e2, d1e79e3, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_ complexed with adp, atp, dcw, gol, mg, so4 |
PDB Entry: 1e79 (more details), 2.4 Å
SCOPe Domain Sequences for d1e79f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79f1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d1e79f1: