Class b: All beta proteins [48724] (180 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins) |
Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species) delta subunit in mitochondria |
Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries) |
Domain d1e79h2: 1e79 H:15-100 [28438] Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79i_ complexed with adp, atp, dcw, gol, mg, so4 |
PDB Entry: 1e79 (more details), 2.4 Å
SCOPe Domain Sequences for d1e79h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79h2 b.93.1.1 (H:15-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk yfvssgsvtvnadssvqllaeeavtl
Timeline for d1e79h2: