Lineage for d3ndrb_ (3ndr B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978380Species Mesorhizobium loti [TaxId:381] [189923] (2 PDB entries)
  8. 978386Domain d3ndrb_: 3ndr B: [182175]
    automated match to d2ew8a1
    complexed with nad

Details for d3ndrb_

PDB Entry: 3ndr (more details), 2.88 Å

PDB Description: Crystal structure of tetrameric pyridoxal 4-dehydrogenase from Mesorhizobium loti
PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d3ndrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndrb_ c.2.1.0 (B:) automated matches {Mesorhizobium loti [TaxId: 381]}
terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
dagmvrh

SCOPe Domain Coordinates for d3ndrb_:

Click to download the PDB-style file with coordinates for d3ndrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ndrb_: