SCOPe 2.01: Domain d3n0ya_: 3n0y A:

Lineage for d3n0ya_ (3n0y A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.0: automated matches [191434] (1 protein)
   not a true family

6. Protein automated matches [190625] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189376] (3 PDB entries)

8. Domain d3n0ya_: 3n0y A: [181764]
   automated match to d2acaa1
   complexed with apc, mn

Details for d3n0ya_

PDB Entry: 3n0y, 1.7 Å

PDB Description: adenylate cyclase class iv with active site ligand apc

PDB Compounds: (A:) Adenylate cyclase 2

SCOPe Domain Sequences for d3n0ya_:

Sequence; same for both SEQRES and ATOM records:

>d3n0ya_ d.63.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf

Timeline for d3n0ya_:

• d3n0ya_ is new in SCOPe 2.01-stable
  
• d3n0ya_ appears in SCOPe 2.02
  
• d3n0ya_ appears in the current release, SCOPe 2.08