Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) |
Family d.63.1.0: automated matches [191434] (1 protein) not a true family |
Protein automated matches [190625] (4 species) not a true protein |
Species Yersinia pestis [TaxId:632] [189376] (3 PDB entries) |
Domain d3n0ya_: 3n0y A: [181764] automated match to d2acaa1 complexed with apc, mn |
PDB Entry: 3n0y (more details), 1.7 Å
SCOPe Domain Sequences for d3n0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0ya_ d.63.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
Timeline for d3n0ya_: