SCOPe 2.02: Domain d3mp9b_: 3mp9 B:

Lineage for d3mp9b_ (3mp9 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)

8. Domain d3mp9b_: 3mp9 B: [181475]
   automated match to d2igga_
   complexed with fmt

Details for d3mp9b_

PDB Entry: 3mp9, 1.2 Å

PDB Description: Structure of Streptococcal protein G B1 domain at pH 3.0

PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d3mp9b_:

Sequence; same for both SEQRES and ATOM records:

>d3mp9b_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
hhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
e

Timeline for d3mp9b_:

• d3mp9b_ first appeared in SCOPe 2.01
  
• d3mp9b_ appears in SCOPe 2.03
  
• d3mp9b_ appears in the current release, SCOPe 2.08, called d3mp9b1