PDB entry 3mp9

View 3mp9 on RCSB PDB site
Description: Structure of Streptococcal protein G B1 domain at pH 3.0
Class: protein binding
Keywords: protein g, igg-binding protein, protein binding
Deposited on 2010-04-26, released 2011-02-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (8-63)
      • expression tag (3-7)
    Domains in SCOPe 2.02: d3mp9a_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (8-63)
      • expression tag (3-7)
    Domains in SCOPe 2.02: d3mp9b_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3mp9A (A:)
hhhhhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktf
tvte

    Sequence, based on observed residues (ATOM records): (download) 
    >3mp9A (A:)
hhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
e

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3mp9B (B:)
hhhhhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktf
tvte

    Sequence, based on observed residues (ATOM records): (download) 
    >3mp9B (B:)
hhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
e