SCOPe 2.02: Domain d3m3ta_: 3m3t A:

Lineage for d3m3ta_ (3m3t A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)

8. Domain d3m3ta_: 3m3t A: [180806]
   automated match to d1uj1b_
   mutant

Details for d3m3ta_

PDB Entry: 3m3t, 2.9 Å

PDB Description: SARS-CoV main protease monomeric Arg298Ala mutant with N-terminal additional residues (Gly-Ser)

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3m3ta_:

Sequence; same for both SEQRES and ATOM records:

>d3m3ta_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll
irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy
ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle
gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn
yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvva
qcsgvtf

Timeline for d3m3ta_:

• d3m3ta_ first appeared in SCOPe 2.01
  
• d3m3ta_ appears in SCOPe 2.03
  
• d3m3ta_ appears in the current release, SCOPe 2.08, called d3m3ta1