Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein automated matches [190384] (8 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries) |
Domain d3m3ta_: 3m3t A: [180806] automated match to d1uj1b_ mutant |
PDB Entry: 3m3t (more details), 2.9 Å
SCOPe Domain Sequences for d3m3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ta_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]} gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvva qcsgvtf
Timeline for d3m3ta_: