Lineage for d1bnpa_ (1bnp A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090716Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1090717Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1090718Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1090827Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 1090838Domain d1bnpa_: 1bnp A: [18080]

Details for d1bnpa_

PDB Entry: 1bnp (more details)

PDB Description: nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1bnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnpa_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
klpgvgtkiaekideflatgklrklek

SCOPe Domain Coordinates for d1bnpa_:

Click to download the PDB-style file with coordinates for d1bnpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bnpa_: