Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries) |
Domain d1bnpa_: 1bnp A: [18080] |
PDB Entry: 1bnp (more details)
SCOPe Domain Sequences for d1bnpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bnpa_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak klpgvgtkiaekideflatgklrklek
Timeline for d1bnpa_: