Lineage for d3ls2b_ (3ls2 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1004084Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1004085Protein automated matches [190543] (18 species)
    not a true protein
  7. 1004149Species Pseudoalteromonas haloplanktis [TaxId:326442] [189288] (1 PDB entry)
  8. 1004151Domain d3ls2b_: 3ls2 B: [180534]
    automated match to d1pv1a_
    complexed with cl

Details for d3ls2b_

PDB Entry: 3ls2 (more details), 2.2 Å

PDB Description: Crystal structure of an S-formylglutathione hydrolase from Pseudoalteromonas haloplanktis TAC125
PDB Compounds: (B:) S-formylglutathione hydrolase

SCOPe Domain Sequences for d3ls2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ls2b_ c.69.1.0 (B:) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
lenissvkvsggwhkqythsavsthctmrfavflppgasesnkvpvlywlsgltctdenf
mqkagafkkaaelgiaivapdtsprgdnvpnedsydfaqgagfyvnatqapynthfnmyd
yvvnelpalieqhfpvtstkaisghsmgghgalmialknpqdyvsasafspivnpincpw
gvkaftgylgadkttwaqydscklmakaeqsnylpmlvsqgdadnfldeqlkpqnlvava
kqkdypltlemqtgydhsyffissfidqhlvfhhqyls

SCOPe Domain Coordinates for d3ls2b_:

Click to download the PDB-style file with coordinates for d3ls2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ls2b_: