Lineage for d3lb8d_ (3lb8 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894041Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1894042Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 1894091Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (18 PDB entries)
  8. 1894120Domain d3lb8d_: 3lb8 D: [180159]
    automated match to d1oqqa_
    complexed with fad, fes

Details for d3lb8d_

PDB Entry: 3lb8 (more details), 2.6 Å

PDB Description: crystal structure of the covalent putidaredoxin reductase- putidaredoxin complex
PDB Compounds: (D:) putidaredoxin

SCOPe Domain Sequences for d3lb8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lb8d_ d.15.4.1 (D:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpd

SCOPe Domain Coordinates for d3lb8d_:

Click to download the PDB-style file with coordinates for d3lb8d_.
(The format of our PDB-style files is described here.)

Timeline for d3lb8d_: