Lineage for d1oqqa_ (1oqq A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) 
Protein 2Fe-2S ferredoxin [54294] (19 species) 
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (18 PDB entries) 
Domain d1oqqa_: 1oqq A: [93422]
complexed with fes; mutant
Details for d1oqqa_
PDB Entry: 1oqq (more details), 1.47 Å
PDB Description: crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution
PDB Compounds: (A:) putidaredoxinSCOPe Domain Sequences for d1oqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqqa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
SCOPe Domain Coordinates for d1oqqa_:
Click to download the PDB-style file with coordinates for d1oqqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oqqa_:
- d1oqqa_ first appeared in SCOP 1.67
- d1oqqa_ appears in SCOPe 2.04
- d1oqqa_ appears in SCOPe 2.06
- d1oqqa_ appears in the current release, SCOPe 2.08
View in 3D
