Lineage for d3l1ta_ (3l1t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016605Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2016606Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2016749Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2016843Protein automated matches [190276] (11 species)
    not a true protein
  7. 2016866Species Escherichia coli K-12 [TaxId:83333] [189512] (1 PDB entry)
  8. 2016867Domain d3l1ta_: 3l1t A: [179858]
    automated match to d1gu6a_
    complexed with ca, edo, hec, so3

Details for d3l1ta_

PDB Entry: 3l1t (more details), 2.3 Å

PDB Description: E. coli NrfA sulfite ocmplex
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3l1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l1ta_ a.138.1.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d3l1ta_:

Click to download the PDB-style file with coordinates for d3l1ta_.
(The format of our PDB-style files is described here.)

Timeline for d3l1ta_: