Class a: All alpha proteins [46456] (284 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (5 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189512] (1 PDB entry) |
Domain d3l1ta_: 3l1t A: [179858] automated match to d1gu6a_ complexed with ca, edo, hec, so3 |
PDB Entry: 3l1t (more details), 2.3 Å
SCOPe Domain Sequences for d3l1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l1ta_ a.138.1.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq dfiktvipqweeqarknglls
Timeline for d3l1ta_: