Lineage for d3kkac_ (3kka C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715571Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2715572Protein automated matches [190031] (3 species)
    not a true protein
  7. 2715581Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2715616Domain d3kkac_: 3kka C: [179398]
    automated match to d1f0ma_
    complexed with cl

Details for d3kkac_

PDB Entry: 3kka (more details), 2.4 Å

PDB Description: co-crystal structure of the sam domains of epha1 and epha2
PDB Compounds: (C:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3kkac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkac_ a.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglk

SCOPe Domain Coordinates for d3kkac_:

Click to download the PDB-style file with coordinates for d3kkac_.
(The format of our PDB-style files is described here.)

Timeline for d3kkac_: