Lineage for d3js9c_ (3js9 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204903Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1205295Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 1205296Protein automated matches [191087] (5 species)
    not a true protein
  7. 1205299Species Babesia bovis [TaxId:484906] [189049] (1 PDB entry)
  8. 1205302Domain d3js9c_: 3js9 C: [178756]
    automated match to d1bhna_
    complexed with so4

Details for d3js9c_

PDB Entry: 3js9 (more details), 2.5 Å

PDB Description: crystal structure of nucleoside diphosphate kinase family protein from babesia bovis
PDB Compounds: (C:) Nucleoside diphosphate kinase family protein

SCOPe Domain Sequences for d3js9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js9c_ d.58.6.0 (C:) automated matches {Babesia bovis [TaxId: 484906]}
mertyimvkpdgvqrgligeilkrfemkglkliaakfehptmdvvaqhycehkdkpffkd
lcdfishgpvfcmiwegpeaikigrnlvgltspvesaagtirgdfgvvknfnivhasssa
edaarecalwftpeqlvtwersvggwiy

SCOPe Domain Coordinates for d3js9c_:

Click to download the PDB-style file with coordinates for d3js9c_.
(The format of our PDB-style files is described here.)

Timeline for d3js9c_: