Lineage for d3iaka_ (3iak A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 927926Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 927927Species Human (Homo sapiens) [TaxId:9606] [89152] (25 PDB entries)
    Uniprot Q08499 388-713
  8. 927984Domain d3iaka_: 3iak A: [178215]
    automated match to d1oyna_
    complexed with ev1, mg, zn

Details for d3iaka_

PDB Entry: 3iak (more details), 2.8 Å

PDB Description: Crystal structure of human phosphodiesterase 4d (PDE4d) with papaverine.
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3iaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaka_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
mteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlit
ylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdh
pgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmv
idivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptk
plqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetw
adlvhpdaqdildtlednrewyqst

SCOPe Domain Coordinates for d3iaka_:

Click to download the PDB-style file with coordinates for d3iaka_.
(The format of our PDB-style files is described here.)

Timeline for d3iaka_: