SCOPe 2.08: Domain d3iaka1: 3iak A:86-409

Lineage for d3iaka1 (3iak A:86-409)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3iaka1: 3iak A:86-409 [178215]
   Other proteins in same PDB: d3iaka2
   automated match to d1oyna_
   complexed with ev1, mg, zn

Details for d3iaka1

PDB Entry: 3iak, 2.8 Å

PDB Description: Crystal structure of human phosphodiesterase 4d (PDE4d) with papaverine.

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3iaka1:

Sequence; same for both SEQRES and ATOM records:

>d3iaka1 a.211.1.2 (A:86-409) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqst

Timeline for d3iaka1:

• d3iaka1 first appeared in SCOPe 2.01, called d3iaka_
  
• d3iaka1 appears in SCOPe 2.07