![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (51 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:99287] [189011] (1 PDB entry) |
![]() | Domain d3iaha_: 3iah A: [178209] automated match to d2c07a1 complexed with act, cl, eoh, nap |
PDB Entry: 3iah (more details), 1.83 Å
SCOPe Domain Sequences for d3iaha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaha_ c.2.1.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]} mhyqpkqdllqnriilvtgasdgigreaaltyarygatvillgrneeklrrvaqhiadeq hvqpqwftldlltctaeecrqvadriaahyprldgvlhnagllgeigpmseqdpqiwqdv mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayatskfategmmqvla deyqnrslrvncinpggtrtsmrasafptedpqklktpadimplylwlmgddsrrktgmt fdaqpgrkpgiaq
Timeline for d3iaha_: