SCOPe 2.06: Domain d3i4wa_: 3i4w A:

Lineage for d3i4wa_ (3i4w A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d3i4wa_: 3i4w A: [178090]
   automated match to d1tp3a1
   complexed with act

Details for d3i4wa_

PDB Entry: 3i4w, 1.35 Å

PDB Description: crystal structure of the third pdz domain of psd-95

PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d3i4wa_:

Sequence; same for both SEQRES and ATOM records:

>d3i4wa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
vdlrnasheqaaialknagqtvtiiaqykpeeysrfea

Timeline for d3i4wa_:

• d3i4wa_ first appeared in SCOPe 2.01
  
• d3i4wa_ appears in SCOPe 2.05
  
• d3i4wa_ appears in SCOPe 2.07
  
• d3i4wa_ appears in the current release, SCOPe 2.08