Lineage for d3i3hb_ (3i3h B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099130Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1099131Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1099136Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 1099243Protein Snake phospholipase A2 [48624] (35 species)
  7. 1099318Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (8 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 1099331Domain d3i3hb_: 3i3h B: [178048]
    automated match to d1pa0a_

Details for d3i3hb_

PDB Entry: 3i3h (more details), 2.17 Å

PDB Description: Crystal structure of Bothropstoxin-I crystallized at 291K
PDB Compounds: (B:) Phospholipase A2 homolog bothropstoxin-1

SCOPe Domain Sequences for d3i3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3hb_ a.133.1.2 (B:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d3i3hb_:

Click to download the PDB-style file with coordinates for d3i3hb_.
(The format of our PDB-style files is described here.)

Timeline for d3i3hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i3ha_