Lineage for d1pa0a_ (1pa0 A:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) Protein Snake phospholipase A2 [48624] (35 species) 
Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (3 PDB entries) 
Domain d1pa0a_: 1pa0 A: [104097]
Details for d1pa0a_
PDB Entry: 1pa0 (more details), 2.2 Å
PDB Description: crystal structure of bnsp-7, a lys49-phospholipase a2
PDB Compounds: (A:) Myotoxic phospholipase A2-likeSCOPe Domain Sequences for d1pa0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pa0a_ a.133.1.2 (A:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]}
slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c
SCOPe Domain Coordinates for d1pa0a_:
Click to download the PDB-style file with coordinates for d1pa0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pa0a_:
- d1pa0a_ first appeared in SCOP 1.69
- d1pa0a_ appears in SCOPe 2.01
- d1pa0a_ appears in SCOPe 2.03
- d1pa0a_ appears in the current release, SCOPe 2.08
View in 3D
