![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (36 species) |
![]() | Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (3 PDB entries) |
![]() | Domain d1pa0a_: 1pa0 A: [104097] |
PDB Entry: 1pa0 (more details), 2.2 Å
SCOPe Domain Sequences for d1pa0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pa0a_ a.133.1.2 (A:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]} slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp c
Timeline for d1pa0a_: