Lineage for d3i1ja_ (3i1j A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978454Species Pseudomonas syringae [TaxId:323] [188999] (1 PDB entry)
  8. 978455Domain d3i1ja_: 3i1j A: [178020]
    automated match to d1vl8a_
    complexed with act, cl, edo, na

Details for d3i1ja_

PDB Entry: 3i1j (more details), 1.9 Å

PDB Description: Structure of a putative short chain dehydrogenase from Pseudomonas syringae
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3i1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1ja_ c.2.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 323]}
gmfdysahpellkgrvilvtgaargigaaaarayaahgasvvllgrteaslaevsdqiks
agqpqpliialnlenataqqyrelaarvehefgrldgllhnasiigprtpleqlpdedfm
qvmhvnvnatfmltrallpllkrsedasiaftsssvgrkgranwgaygvskfateglmqt
ladelegvtavransinpgatrtgmraqaypdenplnnpapedimpvylylmgpdstgin
gqalnaq

SCOPe Domain Coordinates for d3i1ja_:

Click to download the PDB-style file with coordinates for d3i1ja_.
(The format of our PDB-style files is described here.)

Timeline for d3i1ja_: