Lineage for d3ho0b_ (3ho0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728976Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2728977Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
    Uniprot P37231 232-505
  8. 2729204Domain d3ho0b_: 3ho0 B: [177724]
    automated match to d1nyxa_
    protein/DNA complex; complexed with dkd

Details for d3ho0b_

PDB Entry: 3ho0 (more details), 2.6 Å

PDB Description: Crystal structure of the PPARgamma-LBD complexed with a new aryloxy-3phenylpropanoic acid
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3ho0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ho0b_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3ho0b_:

Click to download the PDB-style file with coordinates for d3ho0b_.
(The format of our PDB-style files is described here.)

Timeline for d3ho0b_: