Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (51 species) not a true protein |
Species Escherichia coli [TaxId:217992] [188734] (2 PDB entries) |
Domain d3gz4a_: 3gz4 A: [177103] automated match to d2c07a1 complexed with nap |
PDB Entry: 3gz4 (more details), 2.1 Å
SCOPe Domain Sequences for d3gz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gz4a_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]} qpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrq pqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqv nvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladey qqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtfdaq pg
Timeline for d3gz4a_: