Lineage for d3gz4a_ (3gz4 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978334Species Escherichia coli [TaxId:217992] [188734] (2 PDB entries)
  8. 978337Domain d3gz4a_: 3gz4 A: [177103]
    automated match to d2c07a1
    complexed with nap

Details for d3gz4a_

PDB Entry: 3gz4 (more details), 2.1 Å

PDB Description: crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph
PDB Compounds: (A:) Hypothetical oxidoreductase yciK

SCOPe Domain Sequences for d3gz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gz4a_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}
qpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrq
pqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqv
nvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladey
qqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtfdaq
pg

SCOPe Domain Coordinates for d3gz4a_:

Click to download the PDB-style file with coordinates for d3gz4a_.
(The format of our PDB-style files is described here.)

Timeline for d3gz4a_: