Lineage for d3fw4b_ (3fw4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804448Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2804449Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)
  8. 2804471Domain d3fw4b_: 3fw4 B: [176095]
    automated match to d1ngla_
    complexed with caq, cl, fe, gol, na

Details for d3fw4b_

PDB Entry: 3fw4 (more details), 2.3 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with ferric catechol
PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3fw4b_:

Sequence, based on SEQRES records: (download)

>d3fw4b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksyn
vtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk
vsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Sequence, based on observed residues (ATOM records): (download)

>d3fw4b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqgkwyvvglagnailqkmyatiyelkedkynvtsvlfrkc
dywirtfpgeftlgniksypgltsylvrvvstnynamvffkkvsqnreyfkitlygrtke
ltskslglpenfpvpidqcidg

SCOPe Domain Coordinates for d3fw4b_:

Click to download the PDB-style file with coordinates for d3fw4b_.
(The format of our PDB-style files is described here.)

Timeline for d3fw4b_: