Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
Protein automated matches [191017] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188787] (1 PDB entry) |
Domain d3fifa_: 3fif A: [175823] automated match to d2jn0a1 |
PDB Entry: 3fif (more details), 2.7 Å
SCOPe Domain Sequences for d3fifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fifa_ b.38.1.6 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} sdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh
Timeline for d3fifa_: