SCOPe 2.01: Domain d3f5sa_: 3f5s A:

Lineage for d3f5sa_ (3f5s A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [188679] (2 PDB entries)

8. Domain d3f5sa_: 3f5s A: [175504]
   automated match to d2c07a1

Details for d3f5sa_

PDB Entry: 3f5s, 1.36 Å

PDB Description: crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301

PDB Compounds: (A:) dehydrogenase

SCOPe Domain Sequences for d3f5sa_:

Sequence, based on SEQRES records:

>d3f5sa_ c.2.1.0 (A:) automated matches {Shigella flexneri [TaxId: 623]}
qdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqpqw
fildlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdvmqinvn
atfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladeyqqr
lrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtfdaq

Sequence, based on observed residues (ATOM records):

>d3f5sa_ c.2.1.0 (A:) automated matches {Shigella flexneri [TaxId: 623]}
qdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqpqw
fildlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdvmqinvn
atfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladeyqqr
lrvncinpggtrtpqklktpadimplylwlmgddsrrktgmtfdaq

Timeline for d3f5sa_:

• d3f5sa_ is new in SCOPe 2.01-stable
  
• d3f5sa_ appears in SCOPe 2.02
  
• d3f5sa_ appears in the current release, SCOPe 2.08