Lineage for d3f1la_ (3f1l A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978330Species Escherichia coli K-12 [TaxId:83333] [188668] (2 PDB entries)
  8. 978331Domain d3f1la_: 3f1l A: [175407]
    automated match to d2c07a1

Details for d3f1la_

PDB Entry: 3f1l (more details), 0.95 Å

PDB Description: The 0.95 A structure of an oxidoreductase, yciK from E.coli
PDB Compounds: (A:) Uncharacterized oxidoreductase yciK

SCOPe Domain Sequences for d3f1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f1la_ c.2.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
daqpg

SCOPe Domain Coordinates for d3f1la_:

Click to download the PDB-style file with coordinates for d3f1la_.
(The format of our PDB-style files is described here.)

Timeline for d3f1la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f1lb_