SCOPe 2.01: Domain d3f1ka_: 3f1k A:

Lineage for d3f1ka_ (3f1k A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188668] (2 PDB entries)

8. Domain d3f1ka_: 3f1k A: [175406]
   automated match to d2c07a1
   complexed with nap

Details for d3f1ka_

PDB Entry: 3f1k, 2.6 Å

PDB Description: Crystal Structure of yciK from E. coli, an oxidoreductase, complexed with NADP+ at 2.6A resolution

PDB Compounds: (A:) Uncharacterized oxidoreductase yciK

SCOPe Domain Sequences for d3f1ka_:

Sequence; same for both SEQRES and ATOM records:

>d3f1ka_ c.2.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
daqpgrkpgisq

Timeline for d3f1ka_:

• d3f1ka_ is new in SCOPe 2.01-stable
  
• d3f1ka_ appears in SCOPe 2.02
  
• d3f1ka_ appears in the current release, SCOPe 2.08