Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (11 species) not a true protein |
Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [188968] (6 PDB entries) |
Domain d3em6b_: 3em6 B: [175084] automated match to d1kzka_ complexed with 017, act, po4; mutant |
PDB Entry: 3em6 (more details), 2.1 Å
SCOPe Domain Sequences for d3em6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3em6b_ b.50.1.1 (B:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd qipveicghkvigtvlvgptpvniigrnlltqigctlnf
Timeline for d3em6b_: