SCOPe 2.06: Domain d3ekqb_: 3ekq B:

Lineage for d3ekqb_ (3ekq B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [188968] (6 PDB entries)

8. Domain d3ekqb_: 3ekq B: [175026]
   automated match to d1k6ca_
   complexed with po4, roc

Details for d3ekqb_

PDB Entry: 3ekq, 2.2 Å

PDB Description: crystal structure of inhibitor saquinavir (sqv) in complex with multi- drug resistant hiv-1 protease (l63p/v82t/i84v) (referred to as act in paper)

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ekqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ekqb_ b.50.1.1 (B:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptptniigrnlltqigctlnf

Timeline for d3ekqb_:

• d3ekqb_ first appeared in SCOPe 2.01
  
• d3ekqb_ appears in SCOPe 2.05
  
• d3ekqb_ appears in SCOPe 2.07
  
• d3ekqb_ appears in the current release, SCOPe 2.08