Lineage for d3e5aa_ (3e5a A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979788Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2979789Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries)
  8. 2979801Domain d3e5aa_: 3e5a A: [174670]
    automated match to d1ol5a_
    complexed with so4, vx6

Details for d3e5aa_

PDB Entry: 3e5a (more details), 2.3 Å

PDB Description: Crystal structure of Aurora A in complex with VX-680 and TPX2
PDB Compounds: (A:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3e5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5aa_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d3e5aa_:

Click to download the PDB-style file with coordinates for d3e5aa_.
(The format of our PDB-style files is described here.)

Timeline for d3e5aa_: