Lineage for d3dxme_ (3dxm E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348035Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 2348036Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 2348037Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 2348045Protein automated matches [190347] (1 species)
    not a true protein
  7. 2348046Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries)
  8. 2348050Domain d3dxme_: 3dxm E: [174332]
    Other proteins in same PDB: d3dxma1, d3dxma2, d3dxmb_, d3dxmc_, d3dxmd1, d3dxmd2, d3dxmf_, d3dxmg_
    automated match to d1k8ke_
    complexed with n24

Details for d3dxme_

PDB Entry: 3dxm (more details), 2.85 Å

PDB Description: Structure of Bos taurus Arp2/3 Complex with Bound Inhibitor CK0993548
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3dxme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxme_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOPe Domain Coordinates for d3dxme_:

Click to download the PDB-style file with coordinates for d3dxme_.
(The format of our PDB-style files is described here.)

Timeline for d3dxme_: