Lineage for d3dxmb_ (3dxm B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491533Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 2491534Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 2491542Domain d3dxmb_: 3dxm B: [199310]
    Other proteins in same PDB: d3dxma1, d3dxma2, d3dxmc_, d3dxmd1, d3dxmd2, d3dxme_, d3dxmf_, d3dxmg_
    automated match to d1u2vb1
    complexed with n24

Details for d3dxmb_

PDB Entry: 3dxm (more details), 2.85 Å

PDB Description: Structure of Bos taurus Arp2/3 Complex with Bound Inhibitor CK0993548
PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3dxmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxmb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkiriedppr

SCOPe Domain Coordinates for d3dxmb_:

Click to download the PDB-style file with coordinates for d3dxmb_.
(The format of our PDB-style files is described here.)

Timeline for d3dxmb_: