Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin-related protein 2, Arp2 [69530] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries) Uniprot P61160 143-350 # 100% sequence identity |
Domain d3dxmb_: 3dxm B: [199310] Other proteins in same PDB: d3dxma1, d3dxma2, d3dxmc_, d3dxmd1, d3dxmd2, d3dxme_, d3dxmf_, d3dxmg_ automated match to d1u2vb1 complexed with n24 |
PDB Entry: 3dxm (more details), 2.85 Å
SCOPe Domain Sequences for d3dxmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxmb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd veklskfkiriedppr
Timeline for d3dxmb_: